Anti-Notch1 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application ![]()
| WB |
---|---|
Primary Accession | P46531 |
Host | Rabbit |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Neurogenic locus notch homolog protein 1(NOTCH1) detection. Tested with WB in Human;Mouse. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 4851 |
---|---|
Other Names | Neurogenic locus notch homolog protein 1, Notch 1, hN1, Translocation-associated notch protein TAN-1, Notch 1 extracellular truncation, NEXT, Notch 1 intracellular domain, NICD, NOTCH1, TAN1 |
Calculated MW | 272505 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Mouse, Human |
Subcellular Localization | Cell membrane ; Single-pass type I membrane protein . |
Tissue Specificity | In fetal tissues most abundant in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues. |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Notch1 (1797-1827aa LKNASDGALMDDNQNEWGDEDLETKKFRFEE), identical to the related mouse and rat sequences. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing. |
Name | NOTCH1 |
---|---|
Synonyms | TAN1 |
Function | Functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. Involved in the maturation of both CD4(+) and CD8(+) cells in the thymus. Important for follicular differentiation and possibly cell fate selection within the follicle. During cerebellar development, functions as a receptor for neuronal DNER and is involved in the differentiation of Bergmann glia. Represses neuronal and myogenic differentiation. May play an essential role in postimplantation development, probably in some aspect of cell specification and/or differentiation. May be involved in mesoderm development, somite formation and neurogenesis. May enhance HIF1A function by sequestering HIF1AN away from HIF1A. Required for the THBS4 function in regulating protective astrogenesis from the subventricular zone (SVZ) niche after injury. Involved in determination of left/right symmetry by modulating the balance between motile and immotile (sensory) cilia at the left-right organiser (LRO). |
Cellular Location | Cell membrane {ECO:0000250|UniProtKB:Q01705}; Single-pass type I membrane protein. Late endosome membrane; Single-pass type I membrane protein. Note=Non-activated receptor is targeted for lysosomal degradation via the endosomal pathway; transport from late endosomes to lysosomes requires deuibiquitination by USP12. |
Tissue Location | In fetal tissues most abundant in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Notch proteins are single-pass transmembrane receptors that regulate cell fate decisions during development. The Notch family includes 4 receptors, NOTCH1, NOTCH2, NOTCH3, and NOTCH4, whose ligands include JAG1, JAG2, DLL1, DLL3, and DLL4. Notch homolog 1, translocation-associated (NOTCH1), is a human gene encoding a single-pass transmembrane receptor. It functions as a receptor for membrane bound ligands, and may play multiple roles during development. NOTCH1 may normally coordinates the process of somitogenesis, and the activated Notch 1 and Notch 3 promote differentiation of progenitor cells into astroglia.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.