Anti-NM23A Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB |
---|---|
Primary Accession | P15531 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 4830 |
---|---|
Other Names | Nucleoside diphosphate kinase A, NDK A, NDP kinase A, 2.7.4.6, Granzyme A-activated DNase, GAAD, Metastasis inhibition factor nm23, NM23-H1, Tumor metastatic process-associated protein, NME1, NDPKA, NM23 |
Calculated MW | 17149 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
Subcellular Localization | Cytoplasm . Nucleus . Cell-cycle dependent nuclear localization which can be induced by interaction with Epstein-barr viral proteins or by degradation of the SET complex by GzmA. |
Tissue Specificity | Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to tumor differentiation. Isoform 3 is ubiquitously expressed. . |
Protein Name | Nucleoside diphosphate kinase A |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | NME1 |
---|---|
Synonyms | NDPKA, NM23 |
Function | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination. During GZMA- mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair. |
Cellular Location | Cytoplasm. Nucleus. Note=Cell-cycle dependent nuclear localization which can be induced by interaction with Epstein-barr viral proteins or by degradation of the SET complex by GzmA |
Tissue Location | Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to tumor differentiation. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
NME1(NME/NM23 nucleoside diphosphate kinase 1), also called non-metastatic cells 1, protein (NM23A) expressed in, NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.