Anti-OPN Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application ![]()
| WB, E |
---|---|
Primary Accession | P10451 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Osteopontin(SPP1) detection. Tested with WB, ELISA in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 6696 |
---|---|
Other Names | Osteopontin, Bone sialoprotein 1, Nephropontin, Secreted phosphoprotein 1, SPP-1, Urinary stone protein, Uropontin, SPP1, BNSP, OPN |
Calculated MW | 35423 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat, - ELISA , 0.1-0.5 µg/ml, Human |
Subcellular Localization | Secreted. |
Tissue Specificity | Bone. Found in plasma. |
Protein Name | Osteopontin |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Sequence Similarities | Belongs to the osteopontin family. |
Name | SPP1 |
---|---|
Synonyms | BNSP, OPN |
Function | Major non-collagenous bone protein that binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. |
Cellular Location | Secreted |
Tissue Location | Detected in cerebrospinal fluid and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717) Bone. Found in plasma. |
![citation](/assets/images/v2-nav-citations-img.jpg)
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1). The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.
![FeedBack](/assets/images/pro-review-chat-icon.png)
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.