Anti-Argonaute 4 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB |
---|---|
Primary Accession | Q9HCK5 |
Host | Rabbit |
Reactivity | Human, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Protein argonaute-4(AGO4) detection. Tested with WB in Human;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 192670 |
---|---|
Other Names | Protein argonaute-4 {ECO:0000255|HAMAP-Rule:MF_03033}, Argonaute4 {ECO:0000255|HAMAP-Rule:MF_03033}, hAgo4, Argonaute RISC catalytic component 4, Eukaryotic translation initiation factor 2C 4 {ECO:0000255|HAMAP-Rule:MF_03033}, eIF-2C 4 {ECO:0000255|HAMAP-Rule:MF_03033}, eIF2C 4 {ECO:0000255|HAMAP-Rule:MF_03033}, AGO4, EIF2C4, KIAA1567 |
Calculated MW | 97097 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Rat |
Subcellular Localization | Cytoplasm, P-body . |
Protein Name | Protein argonaute-4 |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | AGO4 |
---|---|
Synonyms | EIF2C4, KIAA1567 |
Function | Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not appear to cleave target mRNAs. Also required for RNA-directed transcription and replication of the human hapatitis delta virus (HDV). |
Cellular Location | Cytoplasm, P-body {ECO:0000255|HAMAP- Rule:MF_03033, ECO:0000269|PubMed:16081698, ECO:0000269|PubMed:19167051} |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.