Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.
> home > Products > Primary Antibodies > Antibody Collections > SARS CoV2 PPIs > Anti-RAB14 Picoband Antibody
Anti-RAB14 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application 
| WB |
|---|---|
| Primary Accession | P61106 |
| Host | Rabbit |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Format | Lyophilized |
| Description | Rabbit IgG polyclonal antibody for Ras-related protein Rab-14(RAB14) detection. Tested with WB in Human;Rat. |
| Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Gene ID | 51552 |
|---|---|
| Other Names | Ras-related protein Rab-14, RAB14 |
| Calculated MW | 23897 MW KDa |
| Application Details | Western blot, 0.1-0.5 µg/ml, Human, Rat |
| Subcellular Localization | Recycling endosome . Early endosome membrane ; Lipid-anchor ; Cytoplasmic side . Golgi apparatus membrane ; Lipid-anchor ; Cytoplasmic side . Golgi apparatus, trans-Golgi network membrane ; Lipid-anchor ; Cytoplasmic side . Cytoplasmic vesicle, phagosome . Recruited to recycling endosomes by DENND6A (PubMed:22595670). Recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211). . |
| Protein Name | Ras-related protein Rab-14 |
| Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RAB14 (124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA), identical to the related mouse and rat sequences. |
| Purification | Immunogen affinity purified. |
| Cross Reactivity | No cross reactivity with other proteins. |
| Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
| Name | RAB14 (HGNC:16524) |
|---|---|
| Function | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (PubMed:22595670). Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development (By similarity). Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes (By similarity). Regulates, together with its guanine nucleotide exchange factor DENND6A, the specific endocytic transport of ADAM10, N-cadherin/CDH2 shedding and cell-cell adhesion (PubMed:22595670). Mediates endosomal tethering and fusion through the interaction with RUFY1 and RAB4B (PubMed:20534812). |
| Cellular Location | Recycling endosome. Early endosome membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle, phagosome. Note=Recruited to recycling endosomes by DENND6A (PubMed:22595670). Recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211). |
Research Areas
Citations (0)
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Application Protocols
Provided below are standard protocols that you may find useful for product applications.
Background
Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes.
Abcepta welcomes feedback from its customers.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.
$ 370.00
Cat# ABO12501
Ordering Information
United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Other Products
Shipping Information
Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
