Anti-PGRMC1 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB, IHC-P |
---|---|
Primary Accession | O00264 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Membrane-associated progesterone receptor component 1(PGRMC1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 10857 |
---|---|
Other Names | Membrane-associated progesterone receptor component 1, mPR, PGRMC1, HPR6.6, PGRMC |
Calculated MW | 21671 MW KDa |
Application Details | Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
Subcellular Localization | Microsome membrane ; Single- pass membrane protein . Endoplasmic reticulum membrane ; Single-pass membrane protein . |
Tissue Specificity | Widely expressed, with highest expression in liver and kidney. |
Protein Name | Membrane-associated progesterone receptor component 1 |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human PGRMC1 (67-102aa RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK), identical to the related mouse sequence, and different from the related rat sequence by two amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | PGRMC1 (HGNC:16090) |
---|---|
Function | Component of a progesterone-binding protein complex (PubMed:28396637). Binds progesterone (PubMed:25675345). Has many reported cellular functions (heme homeostasis, interaction with CYPs). Required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan (By similarity). Intracellular heme chaperone. Regulates heme synthesis via interactions with FECH and acts as a heme donor for at least some hemoproteins (PubMed:27599036). Forms a ternary complex with TMEM97 receptor and low density lipid receptor/LDLR, which increases LDLR-mediated LDL lipoprotein internalization (PubMed:30443021). |
Cellular Location | Microsome membrane {ECO:0000250|UniProtKB:Q95250}; Single-pass membrane protein. Smooth endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane {ECO:0000250|UniProtKB:O55022}; Single-pass membrane protein; Extracellular side {ECO:0000250|UniProtKB:O55022} Secreted Note=Localized at cell membrane, probably in lipid rafts, in serum- starved conditions. |
Tissue Location | Detected in urine (at protein level) (PubMed:36213313, PubMed:37453717). Expressed by endometrial glands and stroma (at protein level) (PubMed:23793472). Widely expressed, with highest expression in liver and kidney. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Progesterone receptor membrane component 1 (PGRMC1) is a protein which co-purifies with progesterone binding proteins in the liver and ovary. In humans, the PGRMC1 protein is encoded by the PGRMC1 gene. The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1. The sole biochemical function of PGRMC1 is heme-binding. PGRMC1 shares key structural motifs with cytochrome b5. It binds and activates P450 proteins, which are important in drug, hormone and lipid metabolism. Also, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1). However, its expression outside of the reproductive tract and in males suggests multiple functions for the protein. These may include binding to Insig (insulin-induced gene), which regulates cholesterol synthesis.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.