Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-MMP-8 Antibody   

Anti-MMP-8 Antibody

     
  • WB - Anti-MMP-8 Antibody ABO12412
    Anti- MMP-8 Picoband antibody, ABO12412, Western blottingAll lanes: Anti MMP-8 (ABO12412) at 0.5ug/mlLane 1: K562 Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 53KDObserved bind size: 60KD
    detail
  • IHC - Anti-MMP-8 Antibody ABO12412
    Anti- MMP-8 Picoband antibody, ABO12412,IHC(P)IHC(P): Human Appendicitis Tissue
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, E
Primary Accession P22894
Host Rabbit
Reactivity Human
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Human.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 4317
Other Names Neutrophil collagenase, 3.4.24.34, Matrix metalloproteinase-8, MMP-8, PMNL collagenase, PMNL-CL, MMP8, CLG1
Calculated MW 53412 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, By Heat

ELISA , 0.1-0.5 µg/ml, Human, -
Western blot, 0.1-0.5 µg/ml, Human
Subcellular Localization Cytoplasmic granule. Secreted, extracellular space, extracellular matrix . Stored in intracellular granules.
Tissue Specificity Neutrophils.
Protein Name Neutrophil collagenase
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human MMP-8 (119-153aa NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ), different from the related mouse sequence by eleven amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins.
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name MMP8
Synonyms CLG1
Function Can degrade fibrillar type I, II, and III collagens.
Cellular Location Cytoplasmic granule. Secreted, extracellular space, extracellular matrix. Note=Stored in intracellular granules
Tissue Location Neutrophils.
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO12412
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthersMexico
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"