Anti-MMP-8 Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB, IHC-P, E |
---|---|
Primary Accession | P22894 |
Host | Rabbit |
Reactivity | Human |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Human. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 4317 |
---|---|
Other Names | Neutrophil collagenase, 3.4.24.34, Matrix metalloproteinase-8, MMP-8, PMNL collagenase, PMNL-CL, MMP8, CLG1 |
Calculated MW | 53412 MW KDa |
Application Details | Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, By Heat ELISA , 0.1-0.5 µg/ml, Human, - Western blot, 0.1-0.5 µg/ml, Human |
Subcellular Localization | Cytoplasmic granule. Secreted, extracellular space, extracellular matrix . Stored in intracellular granules. |
Tissue Specificity | Neutrophils. |
Protein Name | Neutrophil collagenase |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human MMP-8 (119-153aa NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ), different from the related mouse sequence by eleven amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | MMP8 |
---|---|
Synonyms | CLG1 |
Function | Can degrade fibrillar type I, II, and III collagens. |
Cellular Location | Cytoplasmic granule. Secreted, extracellular space, extracellular matrix. Note=Stored in intracellular granules |
Tissue Location | Neutrophils. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.