Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   Anti-Pea3 Picoband Antibody   

Anti-Pea3 Picoband Antibody

     
  • WB - Anti-Pea3 Picoband Antibody ABO12385
    Anti- Pea3 Picoband antibody, ABO12385, Western blottingAll lanes: Anti Pea3 (ABO12385) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 68KD
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession P43268
Host Rabbit
Reactivity Human, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 2118
Other Names ETS translocation variant 4, Adenovirus E1A enhancer-binding protein, E1A-F, Polyomavirus enhancer activator 3 homolog, Protein PEA3, ETV4, E1AF, PEA3
Calculated MW 53938 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Nucleus.
Protein Name ETS translocation variant 4
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name ETV4
Synonyms E1AF, PEA3
Function Transcriptional activator (PubMed:19307308, PubMed:31552090). May play a role in keratinocyte differentiation (PubMed:31552090).
Cellular Location Nucleus {ECO:0000255|PROSITE-ProRule:PRU00237}.
Tissue Location Expressed in keratinocytes.
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO12385
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthersMexico
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"