Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Mitochondrion   >   Anti-Grp75 Picoband Antibody   

Anti-Grp75 Picoband Antibody

     
  • WB - Anti-Grp75 Picoband Antibody ABO12328
    Anti- Grp75 Picoband antibody, ABO12328, Western blottingAll lanes: Anti Grp75 (ABO12328) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Rat Testis Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Thymus Tissue Lysate at 50ugLane 6: Mouse Testis Tissue Lysate at 50ugLane 7: HELA Whole Cell Lysate at 40ugLane 8: MCF-7 Whole Cell Lysate at 40ugLane 9: SW620 Whole Cell Lysate at 40ugLane 10: SMMC Whole Cell Lysate at 40ugPredicted bind size: 74KDObserved bind size: 74KD
    detail
  • IHC - Anti-Grp75 Picoband Antibody ABO12328
    Anti- Grp75 Picoband antibody, ABO12328,IHC(P)IHC(P): Mouse Kidney Tissue
    detail
  • IHC - Anti-Grp75 Picoband Antibody ABO12328
    Anti- Grp75 Picoband antibody, ABO12328,IHC(P)IHC(P): Rat Kidney Tissue
    detail
  • IHC - Anti-Grp75 Picoband Antibody ABO12328
    Anti- Grp75 Picoband antibody, ABO12328,IHC(P)IHC(P): Human Intestinal Cancer Tissue
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession P38646
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 3313
Other Names Stress-70 protein, mitochondrial, 75 kDa glucose-regulated protein, GRP-75, Heat shock 70 kDa protein 9, Mortalin, MOT, Peptide-binding protein 74, PBP74, HSPA9, GRP75, HSPA9B, mt-HSP70
Calculated MW 73680 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat
Subcellular Localization Mitochondrion . Nucleus, nucleolus .
Protein Name Stress-70 protein, mitochondrial
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name HSPA9 (HGNC:5244)
Synonyms GRP75, HSPA9B, mt-HSP70
Function Chaperone protein which plays an important role in mitochondrial iron-sulfur cluster (ISC) biogenesis. Interacts with and stabilizes ISC cluster assembly proteins FXN, NFU1, NFS1 and ISCU (PubMed:26702583). Regulates erythropoiesis via stabilization of ISC assembly (PubMed:21123823, PubMed:26702583). May play a role in cell cycle regulation via its interaction with and promotion of degradation of TP53 (PubMed:24625977, PubMed:26634371). May play a role in the control of cell proliferation and cellular aging (By similarity). Molecular adapter that couples ITPR1 and VDAC1 and directly regulates calcium uptake into mitochondria (PubMed:17178908).
Cellular Location Mitochondrion. Nucleus, nucleolus. Cytoplasm. Mitochondrion matrix {ECO:0000250|UniProtKB:P48721}
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO12328
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"