Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Mitochondrion   >   Anti-CPT1B Picoband Antibody   

Anti-CPT1B Picoband Antibody

     
  • WB - Anti-CPT1B Picoband Antibody ABO12179
    Figure 1. Western blot analysis of CPT1B using anti-CPT1B antibody (ABO12179). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: Rat Skeletal Muscle Tissue Lysate,Lane 2: Rat Cardiac Muscle Tissue Lysate,Lane 3: Mouse Skeletal Muscle Tissue Lysate,Lane 4: Mouse Cardiac Muscle Tissue Lysate,Lane 5: HELA Whole Cell Lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CPT1B antigen affinity purified polyclonal antibody (Catalog # ABO12179) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CPT1B at approximately 88KD. The expected band size for CPT1B is at 88KD.
    detail
  • IHC - Anti-CPT1B Picoband Antibody ABO12179
    Figure 2. IHC analysis of CPT1B using anti-CPT1B antibody (ABO12179).CPT1B was detected in paraffin-embedded section of Mouse Skeletal Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CPT1B Antibody (ABO12179) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
    detail
  • IHC - Anti-CPT1B Picoband Antibody ABO12179
    Figure 3. IHC analysis of CPT1B using anti-CPT1B antibody (ABO12179).CPT1B was detected in paraffin-embedded section of Rat Cardiac Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CPT1B Antibody (ABO12179) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
    detail
  • IHC - Anti-CPT1B Picoband Antibody ABO12179
    Figure 4. IHC analysis of CPT1B using anti-CPT1B antibody (ABO12179).CPT1B was detected in frozen section of mouse cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CPT1B Antibody (ABO12179) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
    detail
  • IHC - Anti-CPT1B Picoband Antibody ABO12179
    Figure 5. IHC analysis of CPT1B using anti-CPT1B antibody (ABO12179).CPT1B was detected in frozen section of rat cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CPT1B Antibody (ABO12179) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immuno electron microscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, IHC-F
Primary Accession Q92523
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 1375
Other Names Carnitine O-palmitoyltransferase 1, muscle isoform, CPT1-M, 2.3.1.21, Carnitine O-palmitoyltransferase I, muscle isoform, CPT I, CPTI-M, Carnitine palmitoyltransferase 1B, Carnitine palmitoyltransferase I-like protein, CPT1B, KIAA1670
Calculated MW 87801 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, By Heat
Immunohistochemistry(Frozen Section), 0.5-1 µg/ml
Western blot, 0.1-0.5 µg/ml
Subcellular Localization Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity Strong expression in heart and skeletal muscle. No expression in liver and kidney.
Protein Name Carnitine O-palmitoyltransferase 1, muscle isoform
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Sequence Similarities Belongs to the carnitine/choline acetyltransferase family.
Protein Information
Name CPT1B
Synonyms KIAA1670
Function Catalyzes the transfer of the acyl group of long-chain fatty acid-CoA conjugates onto carnitine, an essential step for the mitochondrial uptake of long-chain fatty acids and their subsequent beta-oxidation in the mitochondrion.
Cellular Location Mitochondrion outer membrane; Multi-pass membrane protein
Tissue Location Strong expression in heart and skeletal muscle. No expression in liver and kidney
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 370.00
Cat# ABO12179
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"