Anti-CPT1B Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB, IHC-P, IHC-F |
---|---|
Primary Accession | Q92523 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 1375 |
---|---|
Other Names | Carnitine O-palmitoyltransferase 1, muscle isoform, CPT1-M, 2.3.1.21, Carnitine O-palmitoyltransferase I, muscle isoform, CPT I, CPTI-M, Carnitine palmitoyltransferase 1B, Carnitine palmitoyltransferase I-like protein, CPT1B, KIAA1670 |
Calculated MW | 87801 MW KDa |
Application Details | Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, By Heat Immunohistochemistry(Frozen Section), 0.5-1 µg/ml Western blot, 0.1-0.5 µg/ml |
Subcellular Localization | Mitochondrion outer membrane; Multi-pass membrane protein. |
Tissue Specificity | Strong expression in heart and skeletal muscle. No expression in liver and kidney. |
Protein Name | Carnitine O-palmitoyltransferase 1, muscle isoform |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Sequence Similarities | Belongs to the carnitine/choline acetyltransferase family. |
Name | CPT1B |
---|---|
Synonyms | KIAA1670 |
Function | Catalyzes the transfer of the acyl group of long-chain fatty acid-CoA conjugates onto carnitine, an essential step for the mitochondrial uptake of long-chain fatty acids and their subsequent beta-oxidation in the mitochondrion. |
Cellular Location | Mitochondrion outer membrane; Multi-pass membrane protein |
Tissue Location | Strong expression in heart and skeletal muscle. No expression in liver and kidney |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.