Anti-Adenylate Kinase 1 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application ![]()
| WB |
---|---|
Primary Accession | P00568 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Adenylate kinase isoenzyme 1(AK1) detection. Tested with WB in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 203 |
---|---|
Other Names | Adenylate kinase isoenzyme 1 {ECO:0000255|HAMAP-Rule:MF_03171}, AK 1 {ECO:0000255|HAMAP-Rule:MF_03171}, 2.7.4.3 {ECO:0000255|HAMAP-Rule:MF_03171}, 2.7.4.6 {ECO:0000255|HAMAP-Rule:MF_03171}, ATP-AMP transphosphorylase 1 {ECO:0000255|HAMAP-Rule:MF_03171}, ATP:AMP phosphotransferase {ECO:0000255|HAMAP-Rule:MF_03171}, Adenylate monophosphate kinase {ECO:0000255|HAMAP-Rule:MF_03171}, Myokinase {ECO:0000255|HAMAP-Rule:MF_03171}, AK1 {ECO:0000255|HAMAP-Rule:MF_03171} |
Calculated MW | 21635 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
Subcellular Localization | Cytoplasm. |
Protein Name | Adenylate kinase isoenzyme 1 |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | AK1 {ECO:0000255|HAMAP-Rule:MF_03171} |
---|---|
Function | Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP (PubMed:2542324). Exhibits nucleoside diphosphate kinase activity, catalyzing the production of ATP, CTP, GTP, UTP, dATP, dCTP, dGTP and dTTP from the corresponding diphosphate substrates with either ATP or GTP as phosphate donor (PubMed:23416111). Also catalyzes at a very low rate the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP (By similarity). |
Cellular Location | Cytoplasm {ECO:0000250|UniProtKB:P05081}. |
![citation](/assets/images/v2-nav-citations-img.jpg)
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
![FeedBack](/assets/images/pro-review-chat-icon.png)
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.