Anti-CNPase Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application ![]()
| WB |
---|---|
Primary Accession | P09543 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for 2',3'-cyclic-nucleotide 3'-phosphodiesterase(CNP) detection. Tested with WB in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 1267 |
---|---|
Other Names | 2', 3'-cyclic-nucleotide 3'-phosphodiesterase, CNP, CNPase, 3.1.4.37, CNP |
Calculated MW | 47579 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
Subcellular Localization | Membrane; Lipid-anchor. Melanosome. Firmly bound to membrane structures of brain white matter. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. |
Protein Name | 2',3'-cyclic-nucleotide 3'-phosphodiesterase |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human CNPase (142-178aa QYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | CNP (HGNC:2158) |
---|---|
Function | Catalyzes the formation of 2'-nucleotide products from 2',3'- cyclic substrates (By similarity). May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin (By similarity). |
Cellular Location | Membrane {ECO:0000250|UniProtKB:P16330}; Lipid- anchor {ECO:0000250|UniProtKB:P16330}. Melanosome. Note=Firmly bound to membrane structures of brain white matter. {ECO:0000250|UniProtKB:P16330} |
![citation](/assets/images/v2-nav-citations-img.jpg)
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
2',3'-Cyclic-nucleotide 3'-phosphodiesterase, also known as CNPase, is an enzyme that in humans is encoded by the CNP gene. And this gene is mapped to 17q21.2. CNPase is named for its ability to catalyze the phosphodiester hydrolysis of 2',3'-cyclic nucleotides to 2'-nucleotides. CNPase is thought to play a critical role in the events leading up to myelination. Additionally, CNPase has been demonstrated to inhibit the replication of HIV-1 and other primate lentiviruses by binding the retroviral Gag protein and inhibiting the genesis of nascent viral particles.
![FeedBack](/assets/images/pro-review-chat-icon.png)
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.