Anti-SMAD1/SMAD5 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application ![]()
| WB |
---|---|
Primary Accession | Q15797 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for SMAD1/SMAD5 detection. Tested with WB in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 4086 |
---|---|
Other Names | Mothers against decapentaplegic homolog 1, MAD homolog 1, Mothers against DPP homolog 1, JV4-1, Mad-related protein 1, SMAD family member 1, SMAD 1, Smad1, hSMAD1, Transforming growth factor-beta-signaling protein 1, BSP-1, SMAD1, BSP1, MADH1, MADR1 |
Calculated MW | 52260 Da |
Application Details | Western blot, 0.1-0.5 µg/ml |
Subcellular Localization | Cytoplasm. |
Tissue Specificity | Ubiquitous. Highest expression seen in the heart and skeletal muscle. |
Contents | Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK). |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C; for one year. After r˚Constitution, at 4˚C; for one month. It˚Can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing. |
Name | SMAD1 |
---|---|
Synonyms | BSP1, MADH1, MADR1 |
Function | Transcriptional modulator that plays a role in various cellular processes, including embryonic development, cell differentiation, and tissue homeostasis (PubMed:9335504). Upon BMP ligand binding to their receptors at the cell surface, is phosphorylated by activated type I BMP receptors (BMPRIs) and associates with SMAD4 to form a heteromeric complex which translocates into the nucleus acting as transcription factor (PubMed:33667543). In turn, the hetero-trimeric complex recognizes cis-regulatory elements containing Smad Binding Elements (SBEs) to modulate the outcome of the signaling network (PubMed:33667543). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Positively regulates BMP4-induced expression of odontogenic development regulator MSX1 following IPO7-mediated nuclear import (By similarity). |
Cellular Location | Cytoplasm. Nucleus Note=Cytoplasmic in the absence of ligand. Migrates to the nucleus when complexed with SMAD4 (PubMed:15647271). Co-localizes with LEMD3 at the nucleus inner membrane (PubMed:15647271). Exported from the nucleus to the cytoplasm when dephosphorylated (By similarity) {ECO:0000250|UniProtKB:P70340, ECO:0000269|PubMed:15647271} |
Tissue Location | Ubiquitous. Highest expression seen in the heart and skeletal muscle |
![citation](/assets/images/v2-nav-citations-img.jpg)
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
![FeedBack](/assets/images/pro-review-chat-icon.png)
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.